PDB entry 6h8i
View 6h8i on RCSB PDB site
Description: mamm ctd h285d
Deposited on
2018-08-02, released
2019-08-14
The last revision was dated
2019-08-14, with a file datestamp of
2019-08-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Magnetosome protein MamM, Cation efflux protein family
Species: Magnetospirillum gryphiswaldense [TaxId:55518]
Gene: mamM, mgI491, MGR_4095
Database cross-references and differences (RAF-indexed):
- Uniprot Q6NE57 (4-End)
- expression tag (2-3)
- engineered mutation (74)
- Heterogens: SO4, BME, HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence, based on SEQRES records:
>6h8iA (A:)
gshmeavqnriveaaervpgvrgvihlraryvgqdiwadmiigvdpentveqaheiceav
qaavcgkirriesldvsaeareigdttkpsfsdqplsfdevmlskvdn
Sequence, based on observed residues (ATOM records):
>6h8iA (A:)
hmeavqnriveaaervpgvrgvihlraryvgqdiwadmiigvdpentveqaheiceavqa
avcgkirriesldvsaeare