PDB entry 6h8i

View 6h8i on RCSB PDB site
Description: mamm ctd h285d
Deposited on 2018-08-02, released 2019-08-14
The last revision was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Magnetosome protein MamM, Cation efflux protein family
    Species: Magnetospirillum gryphiswaldense [TaxId:55518]
    Gene: mamM, mgI491, MGR_4095
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NE57 (4-End)
      • expression tag (2-3)
      • engineered mutation (74)
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6h8iA (A:)
gshmeavqnriveaaervpgvrgvihlraryvgqdiwadmiigvdpentveqaheiceav
qaavcgkirriesldvsaeareigdttkpsfsdqplsfdevmlskvdn

    Sequence, based on observed residues (ATOM records):
    >6h8iA (A:)
hmeavqnriveaaervpgvrgvihlraryvgqdiwadmiigvdpentveqaheiceavqa
avcgkirriesldvsaeare