PDB entry 6h8h

View 6h8h on RCSB PDB site
Description: Molybdenum storage protein - in a recombinant and in vivo-like form
Class: metal binding protein
Keywords: polyoxomolybdate cluster, molybdenum storage protein, bionanolab, METAL BINDING PROTEIN
Deposited on 2018-08-02, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum storage protein subunit alpha
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: mosA, Avin_43200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h8ha_
  • Chain 'B':
    Compound: Molybdenum storage protein subunit beta
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: mosB, Avin_43210
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 8M0, FUQ, GX2, PO4, ATP, MG, MOO, M27, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h8hA (A:)
    tdttnsikhvisplarqtlqdrdltrpvagkrpirllpwlqvvkiggrvmdrgadailpl
    veelrkllpehrlliltgagvrarhvfsvgldlglpvgslaplaaseagqnghilaamla
    segvsyvehptvadqlaihlsatravvgsafppyhhhefpgsripphradtgaflladaf
    gaagltivenvdgiytadpngpdrgqarflpetsatdlaksegplpvdralldvmatarh
    iervqvvnglvpgrltaalrgehvgtlirtgvrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h8hA (A:)
    rpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvgl
    dlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsaf
    ppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarflp
    etsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirtg
    vrpa
    

  • Chain 'B':
    No sequence available.