PDB entry 6h8f

View 6h8f on RCSB PDB site
Description: fragment of the c-terminal domain of the tssa component of the type vi secretion system from burkholderia cenocepacia
Deposited on 2018-08-02, released 2018-11-21
The last revision was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TssA
    Species: Burkholderia cenocepacia H111 [TaxId:1055524]
    Gene: I35_RS01755
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: TssA
    Species: Burkholderia cenocepacia H111 [TaxId:1055524]
    Gene: I35_RS01755
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6h8fA (A:)
ishmiqnraqavdqlravaryfrqtephspvayladkaaewadmplhkwlesvvkddgsl
shirellgvrpdeqs

    Sequence, based on observed residues (ATOM records):
    >6h8fA (A:)
iqnraqavdqlravaryfrqtephspvayladkaaewadmplhkw

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6h8fB (B:)
ishmiqnraqavdqlravaryfrqtephspvayladkaaewadmplhkwlesvvkddgsl
shirellgvrpdeqs

    Sequence, based on observed residues (ATOM records):
    >6h8fB (B:)
miqnraqavdqlravaryfrqtephspvayladkaaewadmplhkw