PDB entry 6h8b

View 6h8b on RCSB PDB site
Description: Molybdenum storage protein prepared under in vivo-like conditions and incubated with ATP and molybdate at 303 K
Class: metal binding protein
Keywords: Polyoxometalate clusters, molybdenum storage protein, bionanolab, METAL BINDING PROTEIN
Deposited on 2018-08-02, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum storage protein subunit alpha
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h8ba_
  • Chain 'B':
    Compound: Molybdenum storage protein subunit beta
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: J7T, J7N, J8E, FUQ, J7Q, ATP, MG, J8B, J85, MOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h8bA (A:)
    tdttnsikhvisplarqtlqdrdltrpvagkrpirllpwlqvvkiggrvmdrgadailpl
    veelrkllpehrlliltgagvrarhvfsvgldlglpvgslaplaaseagqnghilaamla
    segvsyvehptvadqlaihlsatravvgsafppyhhhefpgsripphradtgaflladaf
    gaagltivenvdgiytadpngpdrgqarflpetsatdlaksegplpvdralldvmatarh
    iervqvvnglvpgrltaalrgehvgtlirtgvrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h8bA (A:)
    krpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvg
    ldlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsa
    fppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarfl
    petsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirt
    gvrpa
    

  • Chain 'B':
    No sequence available.