PDB entry 6h7n

View 6h7n on RCSB PDB site
Description: ACTIVATED TURKEY BETA1 ADRENOCEPTOR WITH BOUND PARTIAL AGONIST XAMOTEROL AND NANOBODY Nb6B9
Class: immune system
Keywords: Beta1 Adrenoceptor, Activated, Partial Agonist, Nanobody, immune system
Deposited on 2018-07-31, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1 adrenergic receptor
    Species: Meleagris gallopavo [TaxId:9103]
    Gene: ADRB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07700 (5-End)
      • expression tag (1-4)
      • engineered mutation (29)
      • engineered mutation (51)
      • engineered mutation (77)
      • conflict (217)
      • engineered mutation (260)
      • engineered mutation (271)
      • engineered mutation (291)
  • Chain 'B':
    Compound: beta-1 adrenergic receptor
    Species: Meleagris gallopavo [TaxId:9103]
    Gene: ADRB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07700 (5-End)
      • expression tag (1-4)
      • engineered mutation (29)
      • engineered mutation (51)
      • engineered mutation (77)
      • conflict (217)
      • engineered mutation (260)
      • engineered mutation (271)
      • engineered mutation (291)
  • Chain 'C':
    Compound: Camelid antibody fragment Nb6B9
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H7N (Start-120)
    Domains in SCOPe 2.07: d6h7nc1, d6h7nc2
  • Chain 'D':
    Compound: Camelid antibody fragment Nb6B9
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H7N (0-120)
    Domains in SCOPe 2.07: d6h7nd_
  • Chain 'E':
    Compound: Thioredoxin 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: trxA, fipA, tsnC, b3781, JW5856
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered mutation (31)
      • engineered mutation (34)
      • expression tag (108)
    Domains in SCOPe 2.07: d6h7ne1, d6h7ne2
  • Chain 'F':
    Compound: Thioredoxin 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: trxA, fipA, tsnC, b3781, JW5856
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered mutation (31)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6h7nf_
  • Heterogens: FVK, NA, 2CV, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h7nC (C:)
    sqvqlqesggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttny
    ansvkgrftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7nC (C:)
    qvqlqesggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttnya
    nsvkgrftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvss
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h7nD (D:)
    sqvqlqesggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttny
    ansvkgrftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvs
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6h7nE (E:)
    sdkiihltddsfdtdvlkadgailvdfwaewsgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7nE (E:)
    kiihltddsfdtdvlkadgailvdfwaewsgpskmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanlae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6h7nF (F:)
    sdkiihltddsfdtdvlkadgailvdfwaewsgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7nF (F:)
    dkiihltddsfdtdvlkadgailvdfwaewsgpskmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla