PDB entry 6h7c

View 6h7c on RCSB PDB site
Description: tRNA guanine transglycosylase H333A mutant apo structure
Class: transferase
Keywords: TGT, Homodimer, PPI, mutation, TRANSFERASE
Deposited on 2018-07-31, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • conflict (311)
      • engineered mutation (332)
    Domains in SCOPe 2.07: d6h7ca_
  • Heterogens: GOL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h7cA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihalirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h7cA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtvkalkpetvratgadiilgntyh
    lmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslstkqseegvtfkshldgsrhml
    spersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaen
    aalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddk
    phylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpld
    sechcavcqkwsrayihalirageilgamlmtehniafyqqlmqkirdsisegrfsqfaq
    dfraryfa