PDB entry 6h75

View 6h75 on RCSB PDB site
Description: SiaP A11N in complex with Neu5Ac (RT)
Class: transport protein
Keywords: TRAP transporter, Sialic acid, TRANSPORT PROTEIN
Deposited on 2018-07-30, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic acid-binding periplasmic protein siaP
    Species: Haemophilus influenzae Rd KW20 [TaxId:71421]
    Gene: siaP, HI_0146
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44542 (0-305)
      • engineered mutation (10)
      • expression tag (306-307)
    Domains in SCOPe 2.07: d6h75a1, d6h75a2
  • Heterogens: SLB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h75A (A:)
    adydlkfgmnngtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
    ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
    qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
    avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
    aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
    ieainphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h75A (A:)
    adydlkfgmnngtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
    ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
    qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
    avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
    aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
    ieainphh