PDB entry 6h74

View 6h74 on RCSB PDB site
Description: The molybdenum storage protein - L131H
Class: metal binding protein
Keywords: Molybdenum storage, bionanolab, POM cluster assembly, METAL BINDING PROTEIN
Deposited on 2018-07-30, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum storage protein subunit alpha
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: mosA, Avin_43200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h74a_
  • Chain 'B':
    Compound: Molybdenum storage protein subunit beta
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: mosB, Avin_43210
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84253 (Start-268)
      • engineered mutation (129)
  • Heterogens: ATP, FUQ, GWW, PO4, MG, GWN, MOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h74A (A:)
    tdttnsikhvisplarqtlqdrdltrpvagkrpirllpwlqvvkiggrvmdrgadailpl
    veelrkllpehrlliltgagvrarhvfsvgldlglpvgslaplaaseagqnghilaamla
    segvsyvehptvadqlaihlsatravvgsafppyhhhefpgsripphradtgaflladaf
    gaagltivenvdgiytadpngpdrgqarflpetsatdlaksegplpvdralldvmatarh
    iervqvvnglvpgrltaalrgehvgtlirtgvrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h74A (A:)
    rpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvgl
    dlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsaf
    ppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarflp
    etsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirtg
    vrpa
    

  • Chain 'B':
    No sequence available.