PDB entry 6h70

View 6h70 on RCSB PDB site
Description: GI.1 human norovirus protruding domain in complex with Nano-62 and 2-fucosyllactose (2FL)
Class: viral protein
Keywords: Norovirus, GI.1, P domain, Nano-62, 2-fucosyllactose, VIRAL PROTEIN
Deposited on 2018-07-30, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Norwalk virus (strain GI/Human/United States/Norwalk/1968) [TaxId:524364]
    Gene: ORF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83884
      • conflict (26)
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Norwalk virus (strain GI/Human/United States/Norwalk/1968) [TaxId:524364]
    Gene: ORF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83884
      • conflict (26)
  • Chain 'C':
    Compound: Nanobody (VHH) Nano-62
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H70 (0-End)
    Domains in SCOPe 2.07: d6h70c1, d6h70c2
  • Chain 'D':
    Compound: Nanobody (VHH) Nano-62
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H70 (0-End)
    Domains in SCOPe 2.07: d6h70d1, d6h70d2
  • Heterogens: NA, EDO, GLC, GAL, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h70C (C:)
    qvqlqesggglvmtggslrlscavsgrtidvsvmawfrqapgkerefvsgmrwsgmttys
    adsvkdrftisrdktkntvylqmnslkpedtavyycaarsrfivgvpqardlydywgqgt
    qvtvssgrypydvpdygsgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h70C (C:)
    qvqlqesggglvmtggslrlscavsgrtidvsvmawfrqapgkerefvsgmrwsgmttys
    adsvkdrftisrdktkntvylqmnslkpedtavyycaarsrfivgvpqardlydywgqgt
    qvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6h70D (D:)
    qvqlqesggglvmtggslrlscavsgrtidvsvmawfrqapgkerefvsgmrwsgmttys
    adsvkdrftisrdktkntvylqmnslkpedtavyycaarsrfivgvpqardlydywgqgt
    qvtvssgrypydvpdygsgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h70D (D:)
    qvqlqesggglvmtggslrlscavsgrtidvsvmawfrqapgkerefvsgmrwsgmttys
    adsvkdrftisrdktkntvylqmnslkpedtavyycaarsrfivgvpqardlydywgqgt
    qvtvss