PDB entry 6h6w

View 6h6w on RCSB PDB site
Description: Molybdenum storage protein- H156A
Class: metal binding protein
Keywords: polyoxometalate cluster assembly, molybdenum storage protein, bionanolab, METAL BINDING PROTEIN
Deposited on 2018-07-30, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum storage protein subunit alpha
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: mosA, Avin_43200
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84308 (Start-274)
      • engineered mutation (154)
    Domains in SCOPe 2.07: d6h6wa_
  • Chain 'B':
    Compound: Molybdenum storage protein subunit beta
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: mosB, Avin_43210
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ATP, FUQ, PO4, MG, 8M0, MOO, MO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h6wA (A:)
    tdttnsikhvisplarqtlqdrdltrpvagkrpirllpwlqvvkiggrvmdrgadailpl
    veelrkllpehrlliltgagvrarhvfsvgldlglpvgslaplaaseagqnghilaamla
    segvsyvehptvadqlaihlsatravvgsafppyahhefpgsripphradtgaflladaf
    gaagltivenvdgiytadpngpdrgqarflpetsatdlaksegplpvdralldvmatarh
    iervqvvnglvpgrltaalrgehvgtlirtgvrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h6wA (A:)
    rpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvgl
    dlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsaf
    ppyahhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarflp
    etsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirtg
    vrpa
    

  • Chain 'B':
    No sequence available.