PDB entry 6h6r

View 6h6r on RCSB PDB site
Description: Fragment Derived XIAP inhibitor
Class: apoptosis
Keywords: inhibitor of apoptosis, caspase inhibitor zinc binding domain, APOPTOSIS
Deposited on 2018-07-30, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (Start-126)
      • initiating methionine (20)
    Domains in SCOPe 2.08: d6h6ra_
  • Heterogens: ZN, NA, FUE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6h6rA (A:)
mgsshhhhhhssglvprgshmnfpnstnlprnpsmadyeariftfgtwiysvnkeqlara
gfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlths
leeclvr

    Sequence, based on observed residues (ATOM records): (download) 
    >6h6rA (A:)
mnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggl
tdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr