PDB entry 6h6o

View 6h6o on RCSB PDB site
Description: ubij-scp2 ubiquinone synthesis protein
Deposited on 2018-07-28, released 2019-02-13
The last revision was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquinone biosynthesis protein UbiJ
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ubiJ, yigP, b3834, JW3811
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADP7 (11-130)
      • expression tag (10)
  • Chain 'B':
    Compound: Ubiquinone biosynthesis protein UbiJ
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ubiJ, yigP, b3834, JW3811
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LMR, PEG, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6h6oA (A:)
    melhhhhhheempfkplvtagiesllntflyrspalktarsrllgkvlrvevkgfstsli
    lvfserqvdvlgewagdadctviayasvlpklrdrqqltalirsgelevqgdiqvvqnfv
    aladlaefdpa
    

    Sequence, based on observed residues (ATOM records):
    >6h6oA (A:)
    empfkplvtagiesllntflyrspalktarsrllgkvlrvevkgfstslilvfserqvdv
    lgewagdadctviayasvlpklrdrqqltalirsgelevqgdiqvvqnfvaladlaefdp
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6h6oB (B:)
    melhhhhhheempfkplvtagiesllntflyrspalktarsrllgkvlrvevkgfstsli
    lvfserqvdvlgewagdadctviayasvlpklrdrqqltalirsgelevqgdiqvvqnfv
    aladlaefdpa
    

    Sequence, based on observed residues (ATOM records):
    >6h6oB (B:)
    fkplvtagiesllntflyrspalktarsrllgkvlrvevkgfstslilvfserqvdvlge
    wagdadctviayasvlpklrdrqqltalirsgelevqgdiqvvqnfvaladlaefd