PDB entry 6h6m

View 6h6m on RCSB PDB site
Description: CR10 murine norovirus protruding domain in complex with the CD300lf receptor and glycochenodeoxycholate (GCDCA)
Class: viral protein
Keywords: CR10, sCD300lf, GCDCA, bile acid, glycochenodeoxycholate, viral protein
Deposited on 2018-07-27, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Murine norovirus GV/CR10/2005/USA [TaxId:463724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: capsid protein
    Species: Murine norovirus GV/CR10/2005/USA [TaxId:463724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: capsid protein
    Species: Murine norovirus GV/CR10/2005/USA [TaxId:463724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: capsid protein
    Species: Murine norovirus GV/CR10/2005/USA [TaxId:463724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h6me_
  • Chain 'F':
    Compound: CMRF35-like molecule 1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h6mf_
  • Heterogens: CHO, EDO, NA, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h6mE (E:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h6mF (F:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvp