PDB entry 6h6j

View 6h6j on RCSB PDB site
Description: Carbomonoxy murine neuroglobin Gly-loop mutant
Class: oxygen binding
Keywords: heme protein, gas sensing, OXYGEN BINDING
Deposited on 2018-07-27, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97 (1-149)
      • expression tag (0)
      • conflict (44)
      • conflict (46)
      • conflict (54)
      • conflict (119)
    Domains in SCOPe 2.08: d6h6ja1, d6h6ja2
  • Heterogens: HEM, CMO, SO4, TRS, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h6jA (A:)
    hmerpeselirqswrvvsrsplehgtvlfarlfalepsllplfqgggqfsspedslsspe
    fldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymleks
    lgpdftpatrtawsrlygavvqamsrgwdg