PDB entry 6h6c

View 6h6c on RCSB PDB site
Description: Carbomonoxy murine neuroglobin F106A mutant
Class: oxygen binding
Keywords: heme protein, gas sensing, OXYGEN BINDING
Deposited on 2018-07-27, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97 (0-150)
      • conflict (54)
      • engineered mutation (105)
      • conflict (119)
    Domains in SCOPe 2.08: d6h6ca_
  • Heterogens: HEM, CMO, SO4, DIO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h6cA (A:)
    merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspe
    fldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssastvgesllymleks
    lgpdftpatrtawsrlygavvqamsrgwdge