PDB entry 6h64

View 6h64 on RCSB PDB site
Description: Crystal structure of the CRD-SAT
Class: sugar binding protein
Keywords: carbohydrate recognition domain, sugar binding protein
Deposited on 2018-07-26, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (Start-155)
      • engineered mutation (34)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d6h64a_
  • Chain 'B':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (Start-155)
      • engineered mutation (34)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d6h64b_
  • Chain 'C':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (Start-155)
      • engineered mutation (34)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d6h64c_
  • Chain 'D':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (Start-155)
      • engineered mutation (34)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d6h64d_
  • Chain 'E':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (Start-155)
      • engineered mutation (34)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d6h64e_
  • Chain 'F':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (Start-155)
      • engineered mutation (34)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d6h64f_
  • Heterogens: LBT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h64A (A:)
    msatgaypatgpygapagplivpynlplpggvvpkmlitilgtvkpnanrialdfqrgnd
    vafhfnprfnennrrvivcntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavn
    dahllqynhrvkklneisklgisgdidltstsytmissgvdlgtenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h64A (A:)
    livpynlplpggvvpkmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc
    ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk
    lgisgdidltstsytmi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h64B (B:)
    msatgaypatgpygapagplivpynlplpggvvpkmlitilgtvkpnanrialdfqrgnd
    vafhfnprfnennrrvivcntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavn
    dahllqynhrvkklneisklgisgdidltstsytmissgvdlgtenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h64B (B:)
    livpynlplpggvvpkmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc
    ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk
    lgisgdidltstsytmi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h64C (C:)
    msatgaypatgpygapagplivpynlplpggvvpkmlitilgtvkpnanrialdfqrgnd
    vafhfnprfnennrrvivcntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavn
    dahllqynhrvkklneisklgisgdidltstsytmissgvdlgtenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h64C (C:)
    livpynlplpggvvpkmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc
    ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk
    lgisgdidltstsytmi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6h64D (D:)
    msatgaypatgpygapagplivpynlplpggvvpkmlitilgtvkpnanrialdfqrgnd
    vafhfnprfnennrrvivcntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavn
    dahllqynhrvkklneisklgisgdidltstsytmissgvdlgtenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h64D (D:)
    livpynlplpggvvpkmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc
    ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk
    lgisgdidltstsytmi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6h64E (E:)
    msatgaypatgpygapagplivpynlplpggvvpkmlitilgtvkpnanrialdfqrgnd
    vafhfnprfnennrrvivcntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavn
    dahllqynhrvkklneisklgisgdidltstsytmissgvdlgtenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h64E (E:)
    livpynlplpggvvpkmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc
    ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk
    lgisgdidltstsytmi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6h64F (F:)
    msatgaypatgpygapagplivpynlplpggvvpkmlitilgtvkpnanrialdfqrgnd
    vafhfnprfnennrrvivcntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavn
    dahllqynhrvkklneisklgisgdidltstsytmissgvdlgtenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h64F (F:)
    livpynlplpggvvpkmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc
    ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk
    lgisgdidltstsytmi