PDB entry 6h5z

View 6h5z on RCSB PDB site
Description: Ferric murine neuroglobin F106A mutant
Class: oxygen binding
Keywords: heme protein, gas sensing, OXYGEN BINDING
Deposited on 2018-07-25, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neuroglobin
  Species: Mus musculus [TaxId:10090]
  Gene: NGB
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ER97 (0-145)
    • conflict (51)
    • engineered mutation (102)
    • conflict (116)
  Domains in SCOPe 2.08: d6h5za_
• Heterogens: HEM, SO4, DIO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6h5zA (A:)
  peselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefld
  hirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssastvgesllymlekslgp
  dftpatrtawsrlygavvqamsrgwd