PDB entry 6h5o

View 6h5o on RCSB PDB site
Description: Crystal structure of PBP2a from MRSA in complex with piperacillin at active site.
Class: hydrolase
Keywords: Penicillin Binding Protein, Hydrolase
Deposited on 2018-07-25, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin binding protein 2 prime
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h5oa1, d6h5oa2, d6h5oa3
  • Chain 'B':
    Compound: penicillin binding protein 2 prime
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h5ob1, d6h5ob2, d6h5ob3
  • Heterogens: JPP, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h5oA (A:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpn
    mmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h5oA (A:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnkqaiessdniffarvalelgskkfekgmkk
    lgvgedipsdypfynaqisnknldneilladsgygqgeilinpvqilsiysalenngnin
    aphllkdtknkvwkkniiskeninlltdgmqqvvnkthkediyrsyanligksgtaeget
    grqigwfisydkdnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h5oB (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpn
    mmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h5oB (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelkmrqigwfisydkdnpnmmmain
    vkdvqdkgmasynakisgkvydelyengnkkydide