PDB entry 6h5h

View 6h5h on RCSB PDB site
Description: a computationally designed drp lyase domain reconstructed from two heterologous fragments
Deposited on 2018-07-24, released 2018-12-12
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polb4
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H5H

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6h5hA (A:)
mkhhhhhhpmsdydipttenlyfqgamggqetlngalvnmlkeegnkalsvgniddalqy
yaaaitldkyphkiksgaeakklpgvgtkiaekideflatgklrklekirqddtsssinf
l

    Sequence, based on observed residues (ATOM records):
    >6h5hA (A:)
etlngalvnmlkeegnkalsvgniddalqyyaaaitldkyphkiksgaeakklpgvgtki
aekideflatg