PDB entry 6h5g

View 6h5g on RCSB PDB site
Description: Crystal structure of DHQ1 from Salmonella typhi covalently modified by ligand 3
Class: lyase
Keywords: lyase activity, chorismate biosynthetic process, 3-dehydroquinase, covalent inhibitor, lyase
Deposited on 2018-07-24, released 2019-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
    Gene: aroD, STY1760, t1231
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h5ga_
  • Heterogens: FQZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6h5gA (A:)
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvlrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn
dlrsvlmilhna