PDB entry 6h5b

View 6h5b on RCSB PDB site
Description: Small GTPase in complex with its GAP
Class: cytosolic protein
Keywords: GTPase and GAP complex, CYTOSOLIC PROTEIN
Deposited on 2018-07-24, released 2019-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mutual gliding-motility protein MglA
    Species: Myxococcus xanthus DK 1622 [TaxId:246197]
    Gene: mglA, MXAN_1925
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: MglB
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Gene: mglB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h5bb_
  • Chain 'C':
    Compound: MglB
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Gene: mglB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h5bc_
  • Heterogens: GSP, MG, EPE, 1PE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h5bB (B:)
    gmgtqlvmyeeeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslaslt
    agnvaamgglakligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrik
    kasdeltkifeslvkktdspgagspfaeisdddidnlfse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h5bB (B:)
    vmyeeeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslasltagnvaa
    mgglakligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrikkasdel
    tkifeslvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h5bC (C:)
    gmgtqlvmyeeeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslaslt
    agnvaamgglakligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrik
    kasdeltkifeslvkktdspgagspfaeisdddidnlfse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h5bC (C:)
    eeeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslasltagnvaamgg
    lakligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrikkasdeltki
    fes