PDB entry 6h4p

View 6h4p on RCSB PDB site
Description: Crystal structure of human KDM4A in complex with compound 16a
Class: oxidoreductase
Keywords: Histone demethylase, Inhibitor, transcription, OXIDOREDUCTASE
Deposited on 2018-07-23, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h4pa_
  • Chain 'B':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h4pb_
  • Chain 'C':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h4pc_
  • Chain 'D':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h4pd_
  • Heterogens: FQ5, ZN, DMS, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h4pA (A:)
    smasesetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasy
    ddiddlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeeler
    kywknltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfg
    mwktsfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflr
    hkmtlisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwiey
    gkqavlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4pA (A:)
    etlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddl
    vipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknl
    tfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsf
    awhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtli
    splmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavl
    cscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h4pB (B:)
    smasesetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasy
    ddiddlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeeler
    kywknltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfg
    mwktsfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflr
    hkmtlisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwiey
    gkqavlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4pB (B:)
    esetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddid
    dlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywk
    nltfnppiygadvngtlyekhvdewnigrlrtildlvegvntpylyfgmwktsfawhted
    mdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplmlk
    kygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscrkm
    vkismdvfvrkfqperyklwkagkdntvidhtlptpeaaef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h4pC (C:)
    smasesetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasy
    ddiddlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeeler
    kywknltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfg
    mwktsfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflr
    hkmtlisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwiey
    gkqavlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4pC (C:)
    psarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvipa
    piqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltfnp
    piygadvngtlyekhvdewnigrlrtildlvekesegvntpylyfgmwktsfawhtedmd
    lysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplmlkky
    gipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscrmvki
    smdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6h4pD (D:)
    smasesetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasy
    ddiddlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeeler
    kywknltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfg
    mwktsfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflr
    hkmtlisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwiey
    gkqavlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4pD (D:)
    psarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvipa
    piqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltfnp
    piygadvngtlyekhvdewnigrlrtildlvekesitiegvntpylyfgmwktsfawhte
    dmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplml
    kkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscrd
    mvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl