PDB entry 6h4g

View 6h4g on RCSB PDB site
Description: Regulatory subunit of a cAMP-independent protein kinase A from Trypanosoma brucei: E311A, T318R, V319A mutant bound to cAMP in the A site
Class: signaling protein
Keywords: Protein kinase A, Regulatory Subunit, Nucleoside-binding protein, SIGNALING PROTEIN
Deposited on 2018-07-21, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase A regulatory subunit
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb11.02.2210
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q385V6
      • engineered mutation (112)
      • engineered mutation (119-120)
    Domains in SCOPe 2.07: d6h4ga1, d6h4ga2
  • Chain 'B':
    Compound: Protein kinase A regulatory subunit
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb11.02.2210
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q385V6
      • engineered mutation (112)
      • engineered mutation (119-120)
    Domains in SCOPe 2.07: d6h4gb1, d6h4gb2
  • Heterogens: CMP, NOS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h4gA (A:)
    grkrrttvrgegidpekaksyvapyfeksedetalilklltynvlfsfldsrdlmtvaga
    mwrvefkqddcimeagqttcdklyiiqdgkadiikegqkvylkvegtavgelalmyqtpr
    aatvkvctpeliawaldrdtyrhlvmgsairrretyiqfltnipflsgldnyeklqlada
    lssdefepgdyiirygeegewlyiilegsvdvvgrdddgnekhvwefgkgdhvgelefln
    nhanvadvvakthvvtaklnrrhfemclgpvidvlkrtsqqpnyeyyqsklkttlraegr
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4gA (A:)
    aksyvapyfeksedetalilklltynvlfsfldsrdlmtvagamwrvefkqddcimeagq
    ttcdklyiiqdgkadiikegqkvylkvegtavgelalmyqtpraatvkvctpeliawald
    rdtyrhlvmgsairrretyiqfltnipflsgldnyeklqladalssdefepgdyiiryge
    egewlyiilegsvdvvgrdddgnekhvwefgkgdhvgeleflnnhanvadvvakthvvta
    klnrrhfemclgpvidvlkrtsqqpnyeyyqskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h4gB (B:)
    grkrrttvrgegidpekaksyvapyfeksedetalilklltynvlfsfldsrdlmtvaga
    mwrvefkqddcimeagqttcdklyiiqdgkadiikegqkvylkvegtavgelalmyqtpr
    aatvkvctpeliawaldrdtyrhlvmgsairrretyiqfltnipflsgldnyeklqlada
    lssdefepgdyiirygeegewlyiilegsvdvvgrdddgnekhvwefgkgdhvgelefln
    nhanvadvvakthvvtaklnrrhfemclgpvidvlkrtsqqpnyeyyqsklkttlraegr
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4gB (B:)
    yvapyfeksedetalilklltynvlfsfldsrdlmtvagamwrvefkqddcimeagqttc
    dklyiiqdgkadiikegqkvylkvegtavgelalmyqtpraatvkvctpeliawaldrdt
    yrhlvmgsairrretyiqfltnipflsgldnyeklqladalssdefepgdyiirygeege
    wlyiilegsvdvvgrdddgnekhvwefgkgdhvgeleflnnhanvadvvakthvvtakln
    rrhfemclgpvidvlkrtsqqpnyeyyqsklk