PDB entry 6h4c

View 6h4c on RCSB PDB site
Description: A polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature.
Class: structural protein
Keywords: SaPI, Repressor, Complex, STRUCTURAL PROTEIN
Deposited on 2018-07-20, released 2019-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dutpase
    Species: Staphylococcus phage phi11 [TaxId:12360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h4ca_
  • Chain 'B':
    Compound: Orf20
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: dutpase
    Species: Staphylococcus phage phi11 [TaxId:12360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h4cc_
  • Chain 'D':
    Compound: Orf20
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: dutpase
    Species: Staphylococcus phage phi11 [TaxId:12360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h4ce_
  • Chain 'F':
    Compound: Orf20
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: dutpase
    Species: Staphylococcus phage phi11 [TaxId:12360]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h4cg_
  • Chain 'H':
    Compound: Orf20
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, NI, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h4cA (A:)
    mhhhhhhssgvdlgtenlyfqsmtntlqvrllsenarmpernhktdagydifsaetvvle
    pqekaviktdvavsipegyvglltsrsgvsskthlvietgkidagyhgnlginikndaia
    sngyitpgvfdikgeidlsdairqygtyqinegdklaqlvivpiwtpelkqveefesvse
    rgekgfgssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4cA (A:)
    tntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
    tsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdair
    qygtyqinegdklaqlvivpiwtpelkqveefe
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h4cC (C:)
    mhhhhhhssgvdlgtenlyfqsmtntlqvrllsenarmpernhktdagydifsaetvvle
    pqekaviktdvavsipegyvglltsrsgvsskthlvietgkidagyhgnlginikndaia
    sngyitpgvfdikgeidlsdairqygtyqinegdklaqlvivpiwtpelkqveefesvse
    rgekgfgssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4cC (C:)
    tntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
    tsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdair
    qygtyqinegdklaqlvivpiwtpelkqveefe
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6h4cE (E:)
    mhhhhhhssgvdlgtenlyfqsmtntlqvrllsenarmpernhktdagydifsaetvvle
    pqekaviktdvavsipegyvglltsrsgvsskthlvietgkidagyhgnlginikndaia
    sngyitpgvfdikgeidlsdairqygtyqinegdklaqlvivpiwtpelkqveefesvse
    rgekgfgssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4cE (E:)
    mtntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgl
    ltsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdai
    rqygtyqinegdklaqlvivpiwtpelkqveefe
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6h4cG (G:)
    mhhhhhhssgvdlgtenlyfqsmtntlqvrllsenarmpernhktdagydifsaetvvle
    pqekaviktdvavsipegyvglltsrsgvsskthlvietgkidagyhgnlginikndaia
    sngyitpgvfdikgeidlsdairqygtyqinegdklaqlvivpiwtpelkqveefesvse
    rgekgfgssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h4cG (G:)
    tntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
    tsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdair
    qygtyqinegdklaqlvivpiwtpelkqveefesv
    

  • Chain 'H':
    No sequence available.