PDB entry 6h49

View 6h49 on RCSB PDB site
Description: a polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature.
Deposited on 2018-07-20, released 2019-08-28
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orf20
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6h49A (A:)
gmegagqmaelpthygtiiktlrkymkltqsklsertgfsqntisnhengnrnigvneie
iygkglgipsyilhrisdefkekgysptlndfgkfdkmysyvnkayyndgdiyyssydly
detikllellkeskinvndidydyvlklykqilstdt

    Sequence, based on observed residues (ATOM records):
    >6h49A (A:)
maelpthygtiiktlrkymkltqsklsertgfsqntisnhengnrnigvneieiygkglg
ipsyilhrisdefkekgysptlndfgkfdkmysyvnkayyndgdiyyssydlydetikll
ellkeskinvndidydyvlklykqils