PDB entry 6h48

View 6h48 on RCSB PDB site
Description: a polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature.
Deposited on 2018-07-20, released 2019-08-28
The last revision was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orf20
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6h48A (A:)
gpgkkrevtieeigefhekylkllftnlethndrkkalaeieklkeesiylgeklrlvpn
hhydaikgkpmyklylyeypdrlehqkkiilekdtn

    Sequence, based on observed residues (ATOM records):
    >6h48A (A:)
evtieeigefhekylkllftnlethndrkkalaeieklkeesiylgeklrkpmyklylye
ypdrlehqkkiilekdt