PDB entry 6h41

View 6h41 on RCSB PDB site
Description: structure of the complex of the il-5 inhibitory peptide af17121 bound to the il-5 receptor il-5ralpha
Deposited on 2018-07-20, released 2018-12-26
The last revision was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-5 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL5RA, IL5R
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01344 (0-308)
      • engineered mutation (59)
  • Chain 'B':
    Compound: val-asp-glu-cys-trp-arg-ile-ile-ala-ser-his-thr-trp-phe-cys-ala-glu-glu
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H41 (0-17)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6h41A (A:)
kisllppvnftikvtglaqvllqwkpnpdqeqrnvnleyqvkinapkeddyetriteska
vtilhkgfsasvrtilqndhsllasswasaelhappgspgtsivnltcttnttednysrl
rsyqvslhctwlvgtdapedtqyflyyrygswteecqeyskdtlgrniacwfprtfilsk
grdwlavlvngsskhsairpfdqlfalhaidqinpplnvtaeiegtrlsiqwekpvsafp
ihcfdyevkihntrngylqieklmtnafisiiddlskydvqvraavssmcreaglwsews
qpiyvgfsr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6h41B (B:)
vdecwriiashtwfcaee