PDB entry 6h3m

View 6h3m on RCSB PDB site
Description: the crystal structure of a human seleno-insulin analog
Deposited on 2018-07-19, released 2019-08-14
The last revision was dated 2020-08-26, with a file datestamp of 2020-08-21.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (5)
      • engineered mutation (10)
  • Chain 'B':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (5)
      • engineered mutation (10)
  • Chain 'D':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (5)
      • engineered mutation (10)
  • Chain 'F':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (5)
      • engineered mutation (10)
  • Chain 'H':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (5)
      • engineered mutation (10)
  • Chain 'J':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (5)
      • engineered mutation (10)
  • Chain 'L':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (5)
      • engineered mutation (10)
  • Chain 'P':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: insulin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered mutation (5)
      • engineered mutation (10)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mA (A:)
giveqactsiaslyqlenycn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6h3mB (B:)
fvnqhlcgshlvealylvcgergffytpkt

    Sequence, based on observed residues (ATOM records):
    >6h3mB (B:)
fvnqhlcgshlvealylvcgergffytpk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mC (C:)
giveqactsiaslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mD (D:)
fvnqhlcgshlvealylvcgergffytpkt

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mE (E:)
giveqactsiaslyqlenycn

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6h3mF (F:)
fvnqhlcgshlvealylvcgergffytpkt

    Sequence, based on observed residues (ATOM records):
    >6h3mF (F:)
fvnqhlcgshlvealylvcgergffytpk

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mG (G:)
giveqactsiaslyqlenycn

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6h3mH (H:)
fvnqhlcgshlvealylvcgergffytpkt

    Sequence, based on observed residues (ATOM records):
    >6h3mH (H:)
fvnqhlcgshlvealylvcgergffytpk

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mI (I:)
giveqactsiaslyqlenycn

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6h3mJ (J:)
fvnqhlcgshlvealylvcgergffytpkt

    Sequence, based on observed residues (ATOM records):
    >6h3mJ (J:)
nqhlcgshlvealylvcgergffytpkt

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mK (K:)
giveqactsiaslyqlenycn

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mL (L:)
fvnqhlcgshlvealylvcgergffytpkt

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mN (N:)
giveqactsiaslyqlenycn

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mP (P:)
fvnqhlcgshlvealylvcgergffytpkt

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >6h3mQ (Q:)
fvnqhlcgshlvealylvcgergffytpkt

    Sequence, based on observed residues (ATOM records):
    >6h3mQ (Q:)
nqhlcgshlvealylvcgergffytpkt

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >6h3mR (R:)
giveqactsiaslyqlenycn