PDB entry 6h3h

View 6h3h on RCSB PDB site
Description: Fab fragment of antibody against fullerene C60
Class: immune system
Keywords: antibody fab fullerene c60, immune system
Deposited on 2018-07-18, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-fullerene antibody Fab fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3H (0-221)
  • Chain 'B':
    Compound: Anti-fullerene antibody Fab fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3H (0-214)
    Domains in SCOPe 2.07: d6h3hb1, d6h3hb2
  • Chain 'C':
    Compound: Anti-fullerene antibody Fab fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3H (0-End)
  • Chain 'D':
    Compound: Anti-fullerene antibody Fab fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H3H (0-214)
    Domains in SCOPe 2.07: d6h3hd1, d6h3hd2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6h3hB (B:)
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
ltltarawerhssyscqvtheghtvekslsradcs

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6h3hD (D:)
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
ltltarawerhssyscqvtheghtvekslsradcs