PDB entry 6h2y

View 6h2y on RCSB PDB site
Description: human Fab 1E6 bound to fHbp variant 3 from Neisseria meningitidis serogroup B
Class: immune system
Keywords: fHbp, Human Fab, Neisseria, Antigen-antibody Complex, IMMUNE SYSTEM
Deposited on 2018-07-17, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Lipoprotein GNA1870
    Species: Neisseria meningitidis [TaxId:487]
    Gene: gna1870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q19KF7 (Start-261)
      • expression tag (262)
  • Chain 'H':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H2Y (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H2Y
    Domains in SCOPe 2.07: d6h2yl1, d6h2yl2
  • Heterogens: EDO, PEG, P33, PG4, HOH

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6h2yL (L:)
    vvsyvltqppslsvapgktatltcggnniagktvhwyqqrpgqapvlvisydsdrpsgip
    erfsgsnsantatltisrveagdeadyycqvwdrnsdhwvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h2yL (L:)
    syvltqppslsvapgktatltcggnniagktvhwyqqrpgqapvlvisydsdrpsgiper
    fsgsnsantatltisrveagdeadyycqvwdrnsdhwvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapte