PDB entry 6h2u

View 6h2u on RCSB PDB site
Description: Crystal structure of human METTL5-TRMT112 complex, the 18S rRNA m6A1832 methyltransferase at 1.6A resolution
Class: transferase
Keywords: rRNA maturation, methyltransferase, translation, ribosome synthesis, TRANSFERASE
Deposited on 2018-07-16, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyltransferase-like protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: METTL5, DC3, HSPC133
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRN9 (Start-208)
      • expression tag (209-210)
    Domains in SCOPe 2.07: d6h2ua1, d6h2ua2
  • Chain 'B':
    Compound: Multifunctional methyltransferase subunit TRM112-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TRMT112, AD-001, HSPC152, HSPC170
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SAM, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h2uA (A:)
    mkkvrlkelesrlqqvdgfekpkllleqyptrphiaacmlytihntyddienkvvadlgc
    gcgvlsigtamlgaglcvgfdidedaleifnrnaeefeltnidmvqcdvcllsnrmsksf
    dtvimnppfgtknnkgtdmaflktalemartavyslhksstrehvqkkaaewkikidiia
    elrydlpasykfhkkksvdievdlirfsfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h2uA (A:)
    kvrlkelesrlqqvdgfekpkllleqyptrphiaacmlytihntyddienkvvadlgcgc
    gvlsigtamlgaglcvgfdidedaleifnrnaeefeltnidmvqcdvcllsnrmsksfdt
    vimnppfgtknnkgtdmaflktalemartavyslhksstrehvqkkaaewkikidiiael
    rydlpasyvdievdlirfsfhh
    

  • Chain 'B':
    No sequence available.