PDB entry 6h2o

View 6h2o on RCSB PDB site
Description: APO structure of Phenylalanine ammonia-lyase from Petroselinum crispum
Class: lyase
Keywords: MIO group, Apo structure, plant enzyme, LYASE
Deposited on 2018-07-14, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine ammonia-lyase 1
    Species: Petroselinum crispum [TaxId:4043]
    Gene: PAL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24481 (Start-715)
      • modified residue (202)
      • engineered mutation (703)
      • engineered mutation (715)
    Domains in SCOPe 2.07: d6h2oa_
  • Chain 'B':
    Compound: phenylalanine ammonia-lyase 1
    Species: Petroselinum crispum [TaxId:4043]
    Gene: PAL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24481 (Start-715)
      • modified residue (202)
      • engineered mutation (703)
      • engineered mutation (715)
    Domains in SCOPe 2.07: d6h2ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h2oA (A:)
    mengngattnghvngngmdfcmktedplywgiaaeamtgshldevkkmvaeyrkpvvklg
    getltisqvaaisardgsgvtvelseaaragvkassdwvmdsmnkgtdsygvttgfgats
    hrrtkqggalqkelirflnagifgngsdntlphsatraamlvrintllqgysgirfeile
    aitkflnqnitpclplrgtitasgdlvplsyiaglltgrpnskavgptgvilspeeafkl
    agveggffelqpkeglalvngtavgsgmasmvlfeanilavlaevmsaifaevmqgkpef
    tdhlthklkhhpgqieaaaimehildgsayvkaaqklhemdplqkpkqdryalrtspqwl
    gpqievirsstkmiereinsvndnplidvsrnkaihggnfqgtpigvsmdntrlaiaaig
    klmfaqfselvndfynnglpsnlsggrnpsldygfkgaeiamasycselqflanpvtnhv
    qsaeqhnqdvnslglissrktseaveilklmsttflvglcqaidlrhleenlkstvkntv
    ssvakrvltmgvngelhpsrfcekdllrvvdreyifayiddpcsatyplmqklrqtlveh
    alkngdnernlstsifqkiatfedelkallpkevesaraalesgnpaipnrieecrsypl
    ykfvrkelgteyltgekvtspgeefekvfiamskgeiidpllesleswngaplpis
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h2oA (A:)
    edplywgiaaeamtgshldevkkmvaeyrkpvvklggetltisqvaaisagvtvelseaa
    ragvkassdwvmdsmnkggalqkelirflnagifgngsdntlphsatraamlvrintllq
    gysgirfeileaitkflnqnitpclplrgtitasgdlvplsyiaglltgrpnskavgptg
    vilspeeafklagveggffelqpkeglalvngtavgsgmasmvlfeanilavlaevmsai
    faevmqgkpeftdhlthklkhhpgqieaaaimehildgsayvkaaqdryalrtspqwlgp
    qievirsstkmiereinsvndnplidvsrnkaihggnfqgtpigvsmdntrlaiaaigkl
    mfaqfselvndfynnglpsnlsggrnpsldygfkgaeiamasycselqflanpvtnhvqs
    aeqhnqdvnslglissrktseaveilklmsttflvglcqaidlrhleenlkstvkntvss
    vakrvltsrfcekdllrvvdreyifayiddpcsatyplmqklrqtlvehalkngdnernl
    stsifqkiatfedelkallpkevesaraalesgnpaipnrieecrsyplykfvrkelgte
    yltgekvtspgeefekvfiamskgeiidpllesleswngaplpis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h2oB (B:)
    mengngattnghvngngmdfcmktedplywgiaaeamtgshldevkkmvaeyrkpvvklg
    getltisqvaaisardgsgvtvelseaaragvkassdwvmdsmnkgtdsygvttgfgats
    hrrtkqggalqkelirflnagifgngsdntlphsatraamlvrintllqgysgirfeile
    aitkflnqnitpclplrgtitasgdlvplsyiaglltgrpnskavgptgvilspeeafkl
    agveggffelqpkeglalvngtavgsgmasmvlfeanilavlaevmsaifaevmqgkpef
    tdhlthklkhhpgqieaaaimehildgsayvkaaqklhemdplqkpkqdryalrtspqwl
    gpqievirsstkmiereinsvndnplidvsrnkaihggnfqgtpigvsmdntrlaiaaig
    klmfaqfselvndfynnglpsnlsggrnpsldygfkgaeiamasycselqflanpvtnhv
    qsaeqhnqdvnslglissrktseaveilklmsttflvglcqaidlrhleenlkstvkntv
    ssvakrvltmgvngelhpsrfcekdllrvvdreyifayiddpcsatyplmqklrqtlveh
    alkngdnernlstsifqkiatfedelkallpkevesaraalesgnpaipnrieecrsypl
    ykfvrkelgteyltgekvtspgeefekvfiamskgeiidpllesleswngaplpis
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h2oB (B:)
    tedplywgiaaeamtgshldevkkmvaeyrkpvvklggetltisqvaaisarsgvtvels
    eaaragvkassdwvmdsmggalqkelirflnagifgngsdntlphsatraamlvrintll
    qgysgirfeileaitkflnqnitpclplrgtitasgdlvplsyiaglltgrpnskavgpt
    gvilspeeafklagveggffelqpkeglalvngtavgsgmasmvlfeanilavlaevmsa
    ifaevmqgkpeftdhlthklkhhpgqieaaaimehildgsayvkaqdryalrtspqwlgp
    qievirsstkmiereinsvndnplidvsrnkaihggnfqgtpigvsmdntrlaiaaigkl
    mfaqfselvndfynnglpsnlsggrnpsldygfkgaeiamasycselqflanpvtnhvqs
    aeqhnqdvnslglissrktseaveilklmsttflvglcqaidlrhleenlkstvkntvss
    vakrvltlhpsrfcekdllrvvdreyifayiddpcsatyplmqklrqtlvehalkngdne
    rnlstsifqkiatfedelkallpkevesaraalesgnpaipnrieecrsyplykfvrkel
    gteyltgekvtspgeefekvfiamskgeiidpllesleswngaplpis