PDB entry 6h2m

View 6h2m on RCSB PDB site
Description: Long wavelength Mesh&Collect native SAD phasing on microcrystals
Class: sugar binding protein
Keywords: Concanavalin A, Lectin, Long wavelength, Mesh&Collect, Softer X-rays, SUGAR BINDING PROTEIN
Deposited on 2018-07-13, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin-A,Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h2ma_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6h2mA (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan