PDB entry 6h26

View 6h26 on RCSB PDB site
Description: Rabbit muscle phosphoglycerate mutase
Class: isomerase
Keywords: phosphoglycerate, mutase, glycolysis, gluconeogenesis, rabbit, pgam, pgam2, isomerase
Deposited on 2018-07-13, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate mutase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h26a_
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h26A (A:)
    mathrlvmvrhgestwnqenrfcgwfdaelsekgaeeakrgavaikdakmefdicytsvl
    krairtlwtildgtdqmwlpvvrtwrlnerhyggltglnkaetaakhgeeqvkiwrrsfd
    ippppmdekhpyytsiskerryaglkpgelptceslkdtiaralpfwneeiapqikagkr
    vliaahgnslrgivkhlegmsdqaimelnlptgipivyeldqalkptkpmrflgdeetvr
    kameavaaqgkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h26A (A:)
    athrlvmvrhgestwnqenrfcgwfdaelsekgaeeakrgavaikdakmefdicytsvlk
    rairtlwtildgtdqmwlpvvrtwrlnerhyggltglnkaetaakhgeeqvkiwrrsfdi
    ppppmdekhpyytsiskerryaglkpgelptceslkdtiaralpfwneeiapqikagkrv
    liaahgnslrgivkhlegmsdqaimelnlptgipivyeldqalkptkpmrflgdeetvrk
    ame