PDB entry 6h22

View 6h22 on RCSB PDB site
Description: crystal structure of mdm2 bound to a stapled peptide
Deposited on 2018-07-12, released 2019-07-31
The last revision was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (Start-96)
      • conflict (57-58)
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (5-96)
      • conflict (57-58)
  • Chain 'C':
    Compound: stapled peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H22
  • Chain 'D':
    Compound: stapled peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H22
  • Heterogens: FL5, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6h22A (A:)
gplgssqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydaaq
qhivycsndllgdlfgvpsfsvkehrkiytmiyrnlv

    Sequence, based on observed residues (ATOM records):
    >6h22A (A:)
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydaaqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlv

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6h22B (B:)
gplgssqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydaaq
qhivycsndllgdlfgvpsfsvkehrkiytmiyrnlv

    Sequence, based on observed residues (ATOM records):
    >6h22B (B:)
sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydaaqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlv

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6h22C (C:)
ltfaeywaqlas

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6h22D (D:)
ltfaeywaqlas