PDB entry 6h1y

View 6h1y on RCSB PDB site
Description: crystal structure of a chimeric variant of thioredoxin from escherichia coli
Class: oxidoreductase
Keywords: protein thermal stability, loop size optimization, fundamental rules, chimeric proteins, protein stabilization, OXIDOREDUCTASE
Deposited on 2018-07-12, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1,Thioredoxin (TrxA-1),Thioredoxin 1
    Species: Escherichia coli [TaxId:83333]
    Gene: trxA, fipA, tsnC, b3781, JW5856
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h1ya_
  • Chain 'B':
    Compound: Thioredoxin 1,Thioredoxin (TrxA-1),Thioredoxin 1
    Species: Escherichia coli [TaxId:83333]
    Gene: trxA, fipA, tsnC, b3781, JW5856
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h1yb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h1yA (A:)
    sdkiihltddsfdevirnnklilvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h1yB (B:)
    sdkiihltddsfdevirnnklilvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla