PDB entry 6h1y
View 6h1y on RCSB PDB site
Description: crystal structure of a chimeric variant of thioredoxin from escherichia coli
Class: oxidoreductase
Keywords: protein thermal stability, loop size optimization, fundamental rules, chimeric proteins, protein stabilization, OXIDOREDUCTASE
Deposited on
2018-07-12, released
2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-05-15, with a file datestamp of
2019-05-10.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.13
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Thioredoxin 1,Thioredoxin (TrxA-1),Thioredoxin 1
Species: Escherichia coli [TaxId:83333]
Gene: trxA, fipA, tsnC, b3781, JW5856
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6h1ya_ - Chain 'B':
Compound: Thioredoxin 1,Thioredoxin (TrxA-1),Thioredoxin 1
Species: Escherichia coli [TaxId:83333]
Gene: trxA, fipA, tsnC, b3781, JW5856
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6h1yb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6h1yA (A:)
sdkiihltddsfdevirnnklilvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6h1yB (B:)
sdkiihltddsfdevirnnklilvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla