PDB entry 6h1u

View 6h1u on RCSB PDB site
Description: glnh bound to asp, mycobacterium tuberculosis
Deposited on 2018-07-12, released 2018-08-01
The last revision was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable glutamine-binding lipoprotein GlnH (GLNBP)
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: glnH, Rv0411c
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ASP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6h1uA (A:)
lptpvgmeimppqpplppdsssqdcdptaslrpfatkaeadaavadirargrlivgldig
snlfsfrdpitgeitgfdvdiagevardifgvpshveyrilsaaervtalqksqvdivvk
tmsitcerrklvnfstvyldanqrilaprdspitkvsdlsgkrvcvargttslrrireia
pppvivsvvnwadclvalqqreidavstddtilaglveedpylhivgpdmadqpygvgin
ldntglvrfvngtlerirndgtwntlyrkwltvlgpapapptpryvd