PDB entry 6h1l

View 6h1l on RCSB PDB site
Description: Structure of the BM3 heme domain in complex with tioconazole
Class: oxidoreductase
Keywords: P450, azole inhibitor, heme ligation, P450 BM3, OXIDOREDUCTASE
Deposited on 2018-07-12, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional cytochrome P450/NADPH--P450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2Q7T0 (Start-456)
      • conflict (81)
      • conflict (86)
    Domains in SCOPe 2.07: d6h1la_
  • Chain 'B':
    Compound: Bifunctional cytochrome P450/NADPH--P450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2Q7T0 (0-456)
      • conflict (81)
      • conflict (86)
    Domains in SCOPe 2.07: d6h1lb_
  • Heterogens: FJQ, HEM, PO4, TLA, DIO, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h1lA (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h1lA (A:)
    kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
    desrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammvdi
    avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
    eamnklqddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetg
    eplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsyk
    qvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdkti
    wgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedh
    tnyeldiketltlkpegfvvkakskkiplgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h1lB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h1lB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgddllthmlngkdp
    etgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
    sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
    ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
    edhtnyeldiketltlkpegfvvkakskkiplgg