PDB entry 6h1c

View 6h1c on RCSB PDB site
Description: Structure of Ferric uptake regulator from Pseudomonas aeruginosa with manganese.
Class: transcription
Keywords: Ferric uptake regulator, TRANSCRIPTION
Deposited on 2018-07-11, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: fur, PA4764
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03456 (0-End)
      • engineered mutation (85)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6h1ca_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: fur, PA4764
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03456 (0-133)
      • engineered mutation (85)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6h1cb_
  • Heterogens: MN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h1cA (A:)
    mvenselrkaglkvtlprvkilqmldsaeqrhmsaedvykalmeagedvglatvyrvltq
    feaaglvvrhnfdgghavfeladsgahdhmvcvdtgeviefmdaeiekrqkeivrergfe
    lvdanlvlyvrkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h1cA (A:)
    mvenselrkaglkvtlprvkilqmldsaeqrhmsaedvykalmeagedvglatvyrvltq
    feaaglvvrhnfdgghavfeladsgahdhmvcvdtgeviefmdaeiekrqkeivrergfe
    lvdanlvlyvrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h1cB (B:)
    mvenselrkaglkvtlprvkilqmldsaeqrhmsaedvykalmeagedvglatvyrvltq
    feaaglvvrhnfdgghavfeladsgahdhmvcvdtgeviefmdaeiekrqkeivrergfe
    lvdanlvlyvrkkk