PDB entry 6h19

View 6h19 on RCSB PDB site
Description: Crystal structure of ethyl-paraoxon inhibited recombinant human bile salt activated lipase (aged form)
Class: hydrolase
Keywords: Lipase, alpha-beta hydrolase., paraoxon inhibition, aged form, HYDROLASE
Deposited on 2018-07-11, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile salt-activated lipase
    Species: Homo sapiens [TaxId:9606]
    Gene: CEL, BAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19835 (15-546)
      • expression tag (13-14)
      • engineered mutation (199)
      • engineered mutation (311)
    Domains in SCOPe 2.07: d6h19a1, d6h19a2
  • Heterogens: SDP, ZN, ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h19A (A:)
    hhhhhhhhenlyfqsklgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpq
    phpgwqgtlkaknfkkrclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyg
    gaflmgsghganflnnylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrd
    qhmaiawvkrniaafggdpdnitlfgesaggasvslqtlspynkglirraisqsgvalsp
    wviqknplfwakkvaekvgcpvgdaarmaqclkvtdpraltlaykvplagleypmlhyvg
    fvpvidgdfipddpinlyanaadidyiagtnnmdghifasidmpainkgnkkvteedfyk
    lvseftitkglrgakttfdvyteswaqdpsqenkkktvvdfetdvlflvpteialaqhra
    naksaktyaylfshpsrmpvypkwvgadhaddiqyvfgkpfatptgyrpqdrtvskamia
    ywtnfaktgdpnmgdsavpthwepyttensgyleitkkmgsssmkrslrtnflrywtlty
    lalptvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h19A (A:)
    qsklgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpqphpgwqgtlkakn
    fkkrclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyggaflmgsghganf
    lnnylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrdqhmaiawvkrnia
    afggdpdnitlfgesaggasvslqtlspynkglirraisqsgvalspwviqknplfwakk
    vaekvgcpvgdaarmaqclkvtdpraltlaykvplagleypmlhyvgfvpvidgdfipdd
    pinlyanaadidyiagtnnmdghifasidmpainkgnkkvteedfyklvseftitkglrg
    akttfdvyteswaqdpsqenkkktvvdfetdvlflvpteialaqhranaksaktyaylfs
    hpadhaddiqyvfgkpfatptgyrpqdrtvskamiaywtnfaktgdpnmgdsavpthwep
    yttensgyleitkkmgsssmkrslrtnflrywtltylalptvt