PDB entry 6h17

View 6h17 on RCSB PDB site
Description: myxococcus xanthus mgla bound to gtpgammas
Deposited on 2018-07-11, released 2019-11-27
The last revision was dated 2020-11-11, with a file datestamp of 2020-11-06.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mutual gliding-motility protein MglA
    Species: Myxococcus xanthus DK 1622 [TaxId:246197]
    Gene: mglA, MXAN_1925
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GSP, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6h17A (A:)
    msfinyssreinckivyygpglcgkttnlqyiynktaaetkgklislstetdrtlffdfl
    plslgeirgfktrfhlytvpgqvfydasrklilkgvdgvvfvadsqiermeanmeslenl
    rinlaeqgydlnkipyviqynkrdlpnavtveemrkalnhrnipeyqavaptgvgvfdtl
    kavaklvltelkkgghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6h17A (A:)
    sfinyssreinckivyygpglcgkttnlqyiynktaaetkgklislstetdrtlffdflp
    lslgeirgfktrfhlytvpgqvfydasrklilkgvdgvvfvadsqiermeanmeslenlr
    inlaeqgydlnkipyviqynkrdlpnavtveemrkalnhrnipeyqavaptgvgvfdtlk
    avaklvltelkkg