PDB entry 6h16

View 6h16 on RCSB PDB site
Description: Structure of LRP6 P3E3P4E4 in complex with VHH L-P2-D07
Class: signaling protein
Keywords: Inhibitor, complex, signalling protein, SIGNALING PROTEIN
Deposited on 2018-07-11, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Low-density lipoprotein receptor-related protein 6
  Species: Homo sapiens [TaxId:9606]
  Gene: LRP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75581 (0-614)
    • expression tag (615-617)
• Chain 'B':
  Compound: vhh l-p2-d07
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 6H16 (0-118)
  Domains in SCOPe 2.08: d6h16b_
• Heterogens: NAG, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6h16B (B:)
  evqlqesggglvqaggslrlscaasgrtfsiytigwfrqapgkerefvaeitwsggstyy
  adsvkgrftisrdnakntvylqmnslkpedtavyycaaitytrgiykywgqgtqvtvss