PDB entry 6h16

View 6h16 on RCSB PDB site
Description: Structure of LRP6 P3E3P4E4 in complex with VHH L-P2-D07
Class: signaling protein
Keywords: Inhibitor, complex, signalling protein, SIGNALING PROTEIN
Deposited on 2018-07-11, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low-density lipoprotein receptor-related protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: LRP6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75581 (0-614)
      • expression tag (615-617)
  • Chain 'B':
    Compound: vhh l-p2-d07
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H16 (0-118)
    Domains in SCOPe 2.07: d6h16b_
  • Heterogens: NAG, BMA, MAN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h16B (B:)
    evqlqesggglvqaggslrlscaasgrtfsiytigwfrqapgkerefvaeitwsggstyy
    adsvkgrftisrdnakntvylqmnslkpedtavyycaaitytrgiykywgqgtqvtvss