PDB entry 6h15

View 6h15 on RCSB PDB site
Description: Structure of LRP6 P3E3P4E4 in complex with VHH L-P2-B10
Class: signaling protein
Keywords: Inhibitor, complex, signaling protein
Deposited on 2018-07-11, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low-density lipoprotein receptor-related protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: LRP6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75581 (0-614)
      • expression tag (615)
  • Chain 'B':
    Compound: Low-density lipoprotein receptor-related protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: LRP6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75581 (0-614)
      • expression tag (615)
  • Chain 'C':
    Compound: vhh l-p2-b10
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H15 (0-122)
    Domains in SCOPe 2.07: d6h15c_
  • Chain 'D':
    Compound: vhh l-p2-b10
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H15 (0-122)
    Domains in SCOPe 2.07: d6h15d_
  • Heterogens: NAG, BMA, CL, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h15C (C:)
    vqlqesggclvqaggslrlscaasgstfstytigwfrqapgkerefvaaihwdggqtyya
    dsvkgrftisrdnakntvylqmnslkpedtavyycaargrryfdftysdvydywgqgtqv
    tvs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h15D (D:)
    vqlqesggclvqaggslrlscaasgstfstytigwfrqapgkerefvaaihwdggqtyya
    dsvkgrftisrdnakntvylqmnslkpedtavyycaargrryfdftysdvydywgqgtqv
    tvs