PDB entry 6h15

View 6h15 on RCSB PDB site
Description: Structure of LRP6 P3E3P4E4 in complex with VHH L-P2-B10
Class: signaling protein
Keywords: Inhibitor, complex, signaling protein
Deposited on 2018-07-11, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Low-density lipoprotein receptor-related protein 6
  Species: Homo sapiens [TaxId:9606]
  Gene: LRP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75581 (0-614)
    • expression tag (615)
• Chain 'B':
  Compound: Low-density lipoprotein receptor-related protein 6
  Species: Homo sapiens [TaxId:9606]
  Gene: LRP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75581 (0-614)
    • expression tag (615)
• Chain 'C':
  Compound: vhh l-p2-b10
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 6H15 (0-122)
  Domains in SCOPe 2.08: d6h15c_
• Chain 'D':
  Compound: vhh l-p2-b10
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 6H15 (0-122)
  Domains in SCOPe 2.08: d6h15d_
• Heterogens: NAG, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6h15C (C:)
  vqlqesggclvqaggslrlscaasgstfstytigwfrqapgkerefvaaihwdggqtyya
  dsvkgrftisrdnakntvylqmnslkpedtavyycaargrryfdftysdvydywgqgtqv
  tvs
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6h15D (D:)
  vqlqesggclvqaggslrlscaasgstfstytigwfrqapgkerefvaaihwdggqtyya
  dsvkgrftisrdnakntvylqmnslkpedtavyycaargrryfdftysdvydywgqgtqv
  tvs