PDB entry 6h0q

View 6h0q on RCSB PDB site
Description: b1-type acp domain from module 7 of mlsb
Deposited on 2018-07-10, released 2019-03-06
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type I modular polyketide synthase
    Species: Mycobacterium ulcerans (strain Agy99) [TaxId:362242]
    Gene: mlsB, MUP032c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6MZ72 (1-101)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6h0qA (A:)
gaasaatdlaarlnglspqqqqqtlatlvaaatatvlghhtpesispatafkdlgidslt
alelrntlthntgldlpptlifdhptphaltqhlhtrltqsh