PDB entry 6h0o

View 6h0o on RCSB PDB site
Description: Nek2 bound to purine inhibitor
Class: cell cycle
Keywords: Kinase, Mitosis., CELL CYCLE
Deposited on 2018-07-10, released 2018-08-22
Made obsolete by 6sk9 on 2020-06-17

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene: NEK2, NEK2A, NLK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
      • expression tag (271-278)
    Domains in SCOPe 2.07: d6h0oa1, d6h0oa2
  • Heterogens: F9N, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h0oA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h0oA (A:)
    raedyevlytigtrcqkirrksdgkilvwkeldygslrelkhpnivryydriidrtnttl
    yivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalkechrrlkpanvfldgkq
    nvklgdfgtpyymspeqmnneksdiwslgcllyelcalmppftafsqkelagkiregkfr
    ripyrysdelneiitrmlnlkdyhrpsveeilenplilehhhhhh