PDB entry 6h07

View 6h07 on RCSB PDB site
Description: X-ray structure of Lactobacillus brevis alcohol dehydrogenase
Class: oxidoreductase
Keywords: short chain reductases/dehydrogenases, magnesium dependence, R-specific alcohol dehydrogenase, Oxidoreductase
Deposited on 2018-07-06, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: R-specific alcohol dehydrogenase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Gene: radh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h07a_
  • Chain 'B':
    Compound: R-specific alcohol dehydrogenase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Gene: radh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h07b_
  • Heterogens: MG, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h07A (A:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitgrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h07B (B:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitgrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq