PDB entry 6h02

View 6h02 on RCSB PDB site
Description: Crystal structure of human Mediator subunit MED23
Class: transcription
Keywords: Human, Mediator, complex, subunit, TRANSCRIPTION
Deposited on 2018-07-06, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mediator of RNA polymerase II transcription subunit 23
    Species: Homo sapiens [TaxId:9606]
    Gene: MED23, ARC130, CRSP3, DRIP130, KIAA1216, SUR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: LAMA nanobody NB106
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H02 (0-End)
    Domains in SCOPe 2.08: d6h02b_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6h02B (B:)
qvqlvesggglvqagaslrlscavsgrtgsiytmgwfrqapgkerevvarttwtpgstky
adsvkgrvaisrdiakntlylqmnnlkpedtavyycaacaygtcyygdrayeywgqgtqv
tvsshhhhhhepea

    Sequence, based on observed residues (ATOM records): (download) 
    >6h02B (B:)
qvqlvesggglvqagaslrlscavsgrtgsiytmgwfrqapgkerevvarttwtpgstky
adsvkgrvaisrdiakntlylqmnnlkpedtavyycaacaygtcyygdrayeywgqgtqv
tvs