PDB entry 6h01

View 6h01 on RCSB PDB site
Description: Crystal structure of a domain-swapped dark-state sfGFP containing the unnatural amino acid ortho-nitrobenzyl-tyrosine (ONBY) at residue 66
Class: fluorescent protein
Keywords: GFP, unnatural amino acids, domain-swapped, FLUORESCENT PROTEIN
Deposited on 2018-07-06, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (15-End)
      • expression tag (14)
      • conflict (42)
      • chromophore (77)
      • conflict (82)
      • conflict (216)
      • conflict (241)
    Domains in SCOPe 2.08: d6h01a1, d6h01a2
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (15-End)
      • expression tag (14)
      • conflict (42)
      • chromophore (77)
      • conflict (82)
      • conflict (216)
      • conflict (241)
    Domains in SCOPe 2.08: d6h01b1, d6h01b2
  • Chain 'C':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (15-End)
      • expression tag (14)
      • conflict (42)
      • chromophore (77)
      • conflict (82)
      • conflict (216)
      • conflict (241)
    Domains in SCOPe 2.08: d6h01c1, d6h01c2
  • Chain 'D':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (15-End)
      • expression tag (14)
      • conflict (42)
      • chromophore (77)
      • conflict (82)
      • conflict (216)
      • conflict (241)
    Domains in SCOPe 2.08: d6h01d1, d6h01d2
  • Heterogens: FHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h01A (A:)
    mgsshhhhhhgssvskgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkfi
    cttgklpvpwptlvttlxvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktr
    aevkfegdtlvnrielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirh
    nvedgsvqladhyqqntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagi
    tlgmdelykgieenlyfqsnigsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h01A (A:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlxvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
    elkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyq
    qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlgmde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h01B (B:)
    mgsshhhhhhgssvskgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkfi
    cttgklpvpwptlvttlxvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktr
    aevkfegdtlvnrielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirh
    nvedgsvqladhyqqntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagi
    tlgmdelykgieenlyfqsnigsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h01B (B:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlxvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
    elkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyq
    qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlgmd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6h01C (C:)
    mgsshhhhhhgssvskgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkfi
    cttgklpvpwptlvttlxvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktr
    aevkfegdtlvnrielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirh
    nvedgsvqladhyqqntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagi
    tlgmdelykgieenlyfqsnigsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h01C (C:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlxvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
    elkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyq
    qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlgmd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6h01D (D:)
    mgsshhhhhhgssvskgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkfi
    cttgklpvpwptlvttlxvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktr
    aevkfegdtlvnrielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirh
    nvedgsvqladhyqqntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagi
    tlgmdelykgieenlyfqsnigsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h01D (D:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlxvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
    elkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyq
    qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlgmd