PDB entry 6h00

View 6h00 on RCSB PDB site
Description: Crystal structure of human pyridoxine 5-phophate oxidase, R116Q variant
Class: oxidoreductase
Keywords: PNPO, FMN-binding, PNP-oxidase activity, OXIDOREDUCTASE
Deposited on 2018-07-05, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxine-5'-phosphate oxidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNPO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NVS9 (Start-260)
      • variant (115)
    Domains in SCOPe 2.07: d6h00a_
  • Heterogens: SO4, FMN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h00A (A:)
    mtcwlrgvtatfgrpaewpgylshlcgrsaamdlgpmrksyrgdreafeethltsldpvk
    qfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgfrfftnfesqkgke
    ldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqigavvshqssvipd
    reylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlhdrivfrrglptgd
    splgpmthrgeedwlyerlap
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h00A (A:)
    thltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgfrff
    tnfesqkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqigav
    vshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlhdri
    vfrrglgpmthrgeedwlyerlap