PDB entry 6gzp

View 6gzp on RCSB PDB site
Description: Llama nanobody PorM_02 structure determined at room temperature by in-situ diffraction
Class: immune system
Keywords: Llama nanobody, Porphyromonas gingivalis, PorM, IMMUNE SYSTEM
Deposited on 2018-07-04, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GZP
    Domains in SCOPe 2.07: d6gzpa1, d6gzpa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gzpA (A:)
    maqvqlvesggglvqagdslrlscaasgltfnrynmgwfrqapgrerefvasiswsgdrt
    ygtdsvkgrfaisrdnakntmylqmnslkpedtavyycaadrfltrsvkydywgqgtqvt
    vsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gzpA (A:)
    qvqlvesggglvqagdslrlscaasgltfnrynmgwfrqapgrerefvasiswsgdrtyg
    tdsvkgrfaisrdnakntmylqmnslkpedtavyycaadrfltrsvkydywgqgtqvtvs
    s